Skip to contents

Overview

Bio3DView is an R package for biomolecular visualization. It is intended to complement the main Bio3D structural bioinformatics analysis package and the NGLVieweR visualization package.

Major features include the ability to interactively view biomolecular structures (pdb objects from the Bio3D package), structural ensembles (pdbs objects) as well as the results of Normal Mode Analysis (nma objects), Principal Component Analysis (pca objects) and various types of computed dynamic trajectory data (xyz objects). All while using minimal code and sensible defaults.

The package itself contains a number of **view.___()** functions (such as view.pdb(), view.pdbs(), view.pca(), view.nma() and view.xyz()) with the output in each case being an NGLVieweR object that can be further customized and added to using NGLVieweR functions (such as addRepresentation() etc.).

Side-note: In the future all of these view.___() functions will be object oriented and called from a single view() function. However, that is currently not implemented as we continue to explore the most useful features for each individual use case.

To the best of our knowledge the first molecular visualization package in R was Julien Ide’s Rpdb that used rgl to render it’s graphics primitives. At this time, over a decade ago, an early bio3d-view package was published that again used rgl and had contributions from both Juien and Barry (the authors of Rpdb and bio3d). This package had the ability to render interactive 3D visualizations of biomolecular structures from various sources within the bio3d package and serves as a model for the current bio3dview package.

Related contemporary work includes the r3dmol and NGLVieweR packages. Both of these are htmlwidget interfaces to underlying 3Dmol.js and NGL.js libraries respectively. Both packages offer many more representation styles and coloring options for interactive, 3D molecular visualization. We have experimented extensively with both r3dmol and NGLvieweR and found that r3dmol has no atom-based selection ability and the authors have no plans to upgrade to the latest JS library that would enable this feature. Primarily for this reason, and because of the currently superior NGL graphics, we have decided to implement the latest bio3dview with NGLVieweR going forward.

Installation

This bio3dview package is not yet on CRAN but can be installed from GitHub with:

# install.packages("pak")
pak::pak("bioboot/bio3dview")

Dependencies include the CRAN packages bio3d and NGLVieweR, which can be installed from CRAN with:

install.packages("bio3d")
install.packages("NGLVieweR")

Basic usage

First load all three related companion packages:

Let’s begin with reading an online PDB structure of HRas (with PDB code: 5p21) and generating the default rainbow colored protein cartoon with bound nucleotide ligand and ions highlighted in atom colored licorice representation.

ras <- read.pdb("5p21")
#>   Note: Accessing on-line PDB file
view.pdb(ras)

If you are young and hip and prefer to use pipes you can obviously do the same thing this way:

"5p21" |> 
  read.pdb() |> 
  view.pdb()

You can customize the display in many ways, for example lets color by secondary structure, change the background color and highlight some key residues as spacefill/vdw:

view.pdb(ras, backgroundColor = "pink", colorScheme="sse",
         highlight = atom.select(ras, resno=45:48),
         highlight.style="vdw")

You can always save the returned object and add to them later, for example

v <- view.pdb(ras, water.rm = TRUE)
addRepresentation(v, "ball+stick") |>
  setSpin()

Multi-model files

The view.pdb() function is designed to deal with multi-model files produced as trajectories from bio3d or obtained from any other source such as NMR structures, for example:

pdb <- read.pdb("2MPS", multi=TRUE)
#>   Note: Accessing on-line PDB file
view.pdb(pdb) 

Multiple structure ensembles

To view pdbs multi-structure objects from bio3d use the view.pdbs() function, for example:

data(transducin)
attach(transducin)

view.pdbs(pdbs)

The default above is to color each structure individually using VMD colors (as returned from vmd_colors(). These can be changed with the cols input argument to view.pdbs() as shown further below. Before that it is often useful to color by residue index, for example:

view.pdbs(pdbs, colorScheme="resi")

Or by

view.pdbs(pdbs, representation="tube", cols=annotation[,"color"])

And using some vector to color by see old vec2color() here:

## define a color scale for RMSF vector
#rf=vec2color(rmsf(pdbs$xyz))
rf <- rmsf(pdbs$xyz)
#view.pdbs(pdbs, b=rf)


##- 3. View the results of PCA on this structure set (i.e. a \sQuote{xyz} class object)
example(pca.xyz) ## Press RTN.

a <- mktrj.pca(pc.xray, pc=1, file="pc1.pdb")
view.xyz(a, col="gray")

# Use d.cut option to increase C-alpha to C-alpha 'trace/bonding' distance if required
view.xyz(a, col=vec2color(rmsf(a)), d.cut=6) 



## Use add=TRUE to add to previous view
view(pdbs)
view(a, col="#808080", add=T)



##- 4. View the results of NMA (i.e. a \sQuote{xyz} class object)
modes <- nma( read.pdb("1hel") )
m7 <- mktrj.nma(modes, mode=7, file="mode_7.pdb")
view.xyz(m7, col=vec2color(rmsf(m7)))  


##- 5. View the results of CNA (i.e. a \sQuote{cna} class object)
#example(plot.cna)
#visualize.cna(net, pdb, xyz.axes=F)
##=> cant turn axis off curently. To be updated as a view function...



##- 6. Simple subregion highlighting
pdbfile <- system.file("examples/hivp.pdb", package="bio3d")
pdb <- read.pdb(pdbfile)

## Select and color residues 24 to 27 in both chains
inds <- atom.select(pdb, resno=c(24:27))
mycols <- rep("white", nrow(pdb$atom))
mycols[inds$atom] <- "red"

view(pdb, col=mycols)
view.xyz(pdb$xyz[inds$xyz], col="green", type="s", add=TRUE)


## Motif example highlighting should be easier than the below
##   Ideally allowing updating of the current display with selections

## Lets color motif position
pdb <- read.pdb("5p21")
motif <- "G....GK[ST]"
aa.seq <- pdbseq(pdb)
pos <- motif.find(motif, aa.seq)

aa.seq[pos]

col <- rep("gray", nrow(pdb$atom))
col[ pdb$atom$resno %in% names(aa.seq[pos]) ] = "red"

view(pdb, "calpha", col=col)



##-- Define a color scale for B-factor coloring etc!!
v <- vec2color( pdb$atom$b )
view.pdb(pdb, "overview", col=v)
}
}
n <- nma(ras)
#>  Building Hessian...     Done in 0.009 seconds.
#>  Diagonalizing Hessian...    Done in 0.109 seconds.
view.nma(n)
#plot(n, sse=ras)

Not working yet!

#view.nma(n, pdb=ras, b=n$fluctuations, colorScheme = "b")

Reading PDB file data into R

To read a single PDB file with Bio3D we can use the read.pdb() function. The minimal input required for this function is a specification of the file to be read. This can be either the file name of a local file on disc, or the RCSB PDB identifier of a file to read directly from the on-line PDB repository. For example to read and inspect the on-line file with PDB ID 1HSG:

pdb <- read.pdb("1hsg")
#>   Note: Accessing on-line PDB file

To get a quick summary of the contents of the pdb object you just created you can issue the command print(pdb) or simply type pdb (which is equivalent in this case):

pdb
#> 
#>  Call:  read.pdb(file = "1hsg")
#> 
#>    Total Models#: 1
#>      Total Atoms#: 1686,  XYZs#: 5058  Chains#: 2  (values: A B)
#> 
#>      Protein Atoms#: 1514  (residues/Calpha atoms#: 198)
#>      Nucleic acid Atoms#: 0  (residues/phosphate atoms#: 0)
#> 
#>      Non-protein/nucleic Atoms#: 172  (residues: 128)
#>      Non-protein/nucleic resid values: [ HOH (127), MK1 (1) ]
#> 
#>    Protein sequence:
#>       PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
#>       QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPQITLWQRPLVTIKIGGQLKE
#>       ALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYDQILIEICGHKAIGTVLVGPTP
#>       VNIIGRNLLTQIGCTLNF
#> 
#> + attr: atom, xyz, seqres, helix, sheet,
#>         calpha, remark, call

Note that the attributes (+ attr:) of this object are listed on the last couple of lines. To find the attributes of any such object you can use:

attributes(pdb)
#> $names
#> [1] "atom"   "xyz"    "seqres" "helix"  "sheet"  "calpha" "remark" "call"  
#> 
#> $class
#> [1] "pdb" "sse"

To access these individual attributes we use the dollar-attribute name convention that is common with R list objects. For example, to access the atom attribute or component use pdb$atom:

head(pdb$atom)
#>   type eleno elety  alt resid chain resno insert      x      y     z o     b
#> 1 ATOM     1     N <NA>   PRO     A     1   <NA> 29.361 39.686 5.862 1 38.10
#> 2 ATOM     2    CA <NA>   PRO     A     1   <NA> 30.307 38.663 5.319 1 40.62
#> 3 ATOM     3     C <NA>   PRO     A     1   <NA> 29.760 38.071 4.022 1 42.64
#> 4 ATOM     4     O <NA>   PRO     A     1   <NA> 28.600 38.302 3.676 1 43.40
#> 5 ATOM     5    CB <NA>   PRO     A     1   <NA> 30.508 37.541 6.342 1 37.87
#> 6 ATOM     6    CG <NA>   PRO     A     1   <NA> 29.296 37.591 7.162 1 38.40
#>   segid elesy charge
#> 1  <NA>     N   <NA>
#> 2  <NA>     C   <NA>
#> 3  <NA>     C   <NA>
#> 4  <NA>     O   <NA>
#> 5  <NA>     C   <NA>
#> 6  <NA>     C   <NA>

To obtain a quick interactive molecular visualization of any such pdb class object we can use the view.pdb() function:

#view.pdb(pdb)

Saving an image

ToDo: how best to capture such an image? Can we use snapShot() see: https://nvelden.github.io/NGLVieweR/reference/snapShot.html